Independent research-data planningEditorial and review policy
PHPeptide HarborResearch Data Harbor
Menu ▼
Peptide Harbor / Lab Notes

Cyclic analogue dossier

Which identity layers belong in a cagrilintide analytical record?

A dossier for documenting cagrilintide sequence context, the Cys3-Cys8 disulfide, N-terminal acylation, molecular mass, and orthogonal evidence needs.

Reviewed by Peptide Harbor editorial reviewUpdated 2026-08-03Educational research-data guidance

Answer first

Cagrilintide should be recorded as a cyclic, acylated peptide entity rather than a linear sequence plus a purity value. The identity ledger needs the disulfide relationship, lipid-derived side chain, terminal state, formula, mass basis, and the analytical method assigned to each question.

Reviewed Chemical LedgerCagrilintide
Molecular form representedCyclic, acylated cagrilintide entity represented by PubChem CID 171397054
CAS number
1415456-99-3
Molecular formula
C194H312N54O59S2
Average molecular weight
4409 g/mol average molecular weight
Exact mass
4408.2582207 Da
Reviewed peptide designationCagrilintide; cyclic (3 to 8) disulfide, N-terminal C20-diacid acylation, C-terminal prolinamide
Sequence representationIncludes stated terminal and modification notation
KCNTATCATQRLANFLRHSSNNFGPILPPTNVGSNTP-NH2
Structural notes
  • Disulfide connection between Cys3 and Cys8
  • C20-diacid acylation through gamma-Glu and Lys linker context
  • C-terminal prolinamide
Known Aliases / Code Names:CagrilintideNN0174-0833Analogue 23

Field-level sources

PubChem CID 171397054: Cagrilintide

National Library of Medicine / PubChem · accessed 2026-08-03

Supports: name, molecularForm, cas, formula, weight, exactMass, sequence, peptideDesignation, modifications, aliases

Where this framework helps

  • Defining a cyclic peptide reference entity
  • Planning disulfide and modification-site evidence
  • Separating identity measurements from chromatographic profile and composition

Limits to keep visible

  • A reduced or linearized representation is not equivalent to the defined cyclic entity.
  • Public compound fields do not establish a result for a project sample.
  • Combination-product, clinical, dosing, and commercial content is outside this dossier.
01

Document the cyclic topology

The reviewed PubChem record describes a cyclic (3 to 8) disulfide. A sequence record that omits that connection is insufficient for expected-form calculations or a sequence-evidence plan.

02

Treat acylation as part of identity

The lipid-derived side chain and linker belong in the molecular-form statement. They should be included in intact-mass expectations and considered when selecting digestion, fragmentation, or orthogonal workflows.

03

Preserve measurement boundaries

Chromatographic profile, expected-versus-observed mass, disulfide mapping, water, and counter-ion measurements answer different questions. Report each with its own method and limitation.

Primary and official sources

References used for this page

Visible FAQ

Questions research teams ask

Does a sequence list prove the cagrilintide disulfide?

No. The list identifies residues, while disulfide connectivity is a structural relationship that requires its own evidence when it matters to the project.

Why retain both average and exact mass?

They are different calculated properties. The analytical report should state which mass convention is being compared with the observed result.

Is this a CagriSema combination record?

No. This page describes the cagrilintide molecular entity only and intentionally excludes combination-product sourcing or sales language.